Structure of PDB 4qae Chain E Binding Site BS01

Receptor Information
>4qae Chain E (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGLAGNEVLREDKDPMKMWA
TIYELEEDKSYNVTIVMPLAEKCEYLFQTFVPGSQPGEFTLGTSGLVRVV
STNYNQHAMVFFKVVWQNREVFWVTLYGRTKELTSELKENFIRFSKSLGL
PENHIVFPVPIDQCID
Ligand information
>4qae Chain T (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HFPICIFCCGCCHRSKCGMCCKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qae Structure of a hepcidin-binding anticalin in complex with its peptide ligand
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E40 L42 E44 W52 I68 M70 L79 Q81 T104 V125 W127 V132 W134
Binding residue
(residue number reindexed from 1)		E37 L39 E41 W49 I65 M67 L76 Q78 T93 V114 W116 V121 W123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0036094 small molecule binding
GO:0042802 identical protein binding
GO:0140315 iron ion sequestering activity
GO:1903981 enterobactin binding
Biological Process
GO:0006826 iron ion transport
GO:0006915 apoptotic process
GO:0015891 siderophore transport
GO:0042742 defense response to bacterium
GO:0045087 innate immune response
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0031410 cytoplasmic vesicle
GO:0035580 specific granule lumen
GO:0060205 cytoplasmic vesicle lumen
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qae, PDBe:4qae, PDBj:4qae
PDBsum4qae
PubMed
UniProtP80188|NGAL_HUMAN Neutrophil gelatinase-associated lipocalin (Gene Name=LCN2)

[Back to BioLiP]