Structure of PDB 4psx Chain E Binding Site BS01

Receptor Information
>4psx Chain E (length=361) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQ
ELIIGTHTSGEEENYLKFAEINLPKEILSNIRITAKYEHEEEITRARYMP
QDPNIVATINGQGTTFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLS
GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVS
EDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYL
YDLRNMKEPLHHMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQI
GAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQ
VWKCSHSLPIV
Ligand information
>4psx Chain P (length=10) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4psx Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
Resolution2.509 Å
Binding residue
(original residue number in PDB)		T34 W35 P36 H64 T65 S66 E69 E120 T122 N162 Y164 N212 E229 N255 M272 N356 E373 N375
Binding residue
(residue number reindexed from 1)		T27 W28 P29 H57 T58 S59 E62 E92 T94 N134 Y136 N184 E201 N227 M244 N328 E345 N347
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0042393 histone binding
Biological Process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0031509 subtelomeric heterochromatin formation
Cellular Component
GO:0000123 histone acetyltransferase complex
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0033698 Rpd3L complex
GO:0070210 Rpd3L-Expanded complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4psx, PDBe:4psx, PDBj:4psx
PDBsum4psx
PubMed24835250
UniProtP39984|HAT2_YEAST Histone acetyltransferase type B subunit 2 (Gene Name=HAT2)

[Back to BioLiP]