Structure of PDB 4ozh Chain E Binding Site BS01

Receptor Information
>4ozh Chain E (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTTQPPSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGL
KNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVWGGATNKLIFG
TGTLLAVQPNIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYI
TDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ozh T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
N36 G109
Binding residue
(residue number reindexed from 1)
N29 G92
Enzymatic activity
Enzyme Commision number ?
External links