Structure of PDB 4ou7 Chain E Binding Site BS01

Receptor Information
>4ou7 Chain E (length=71) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGK
VFHHVQWQQKLARSLQIGRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ou7 Crystal structure of DnaT84-153-dT10 ssDNA complex reveals a novel single-stranded DNA binding mode.
Resolution2.83 Å
Binding residue
(original residue number in PDB)
Y127 W128 R146 S147 I150
Binding residue
(residue number reindexed from 1)
Y44 W45 R63 S64 I67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4ou7, PDBe:4ou7, PDBj:4ou7
PDBsum4ou7
PubMed25053836
UniProtP0A8J2|DNAT_ECOLI Primosomal protein 1 (Gene Name=dnaT)

[Back to BioLiP]