Structure of PDB 4mbe Chain E Binding Site BS01

Receptor Information
>4mbe Chain E (length=51) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQA
S
Ligand information
>4mbe Chain H (length=10) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VLPTVGFDFI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mbe Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
Resolution2.612 Å
Binding residue
(original residue number in PDB)		E767 L768 A771 F772 H774 E775 Y778
Binding residue
(residue number reindexed from 1)		E13 L14 A17 F18 H20 E21 Y24
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4mbe, PDBe:4mbe, PDBj:4mbe
PDBsum4mbe
PubMed24705649
UniProtP46674|SAC3_YEAST Nuclear mRNA export protein SAC3 (Gene Name=SAC3)

[Back to BioLiP]