Structure of PDB 4l18 Chain E Binding Site BS01

Receptor Information
>4l18 Chain E (length=141) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGT
LVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTIT
VFTNPPQVATYHRAIKITVDGPREPRGSLSFSERLSELEQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l18 Structural basis of Ets1 activation by Runx1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R139 R142 G143 K167 V170 D171
Binding residue
(residue number reindexed from 1)		R88 R91 G92 K116 V119 D120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l18, PDBe:4l18, PDBj:4l18
PDBsum4l18
PubMed24646888
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]