Structure of PDB 4ka4 Chain E Binding Site BS01

Receptor Information
>4ka4 Chain E (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMD
EQSKAWTIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ka4 Crystal structure of a proteolytically defined Zbeta domain of human DAI (ZBP1, DLM-1)
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R124 K138 N141 R142 Y145 K160
Binding residue
(residue number reindexed from 1)		R18 K32 N35 R36 Y39 K54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity
Biological Process
GO:0060340 positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ka4, PDBe:4ka4, PDBj:4ka4
PDBsum4ka4
PubMed
UniProtQ9H171|ZBP1_HUMAN Z-DNA-binding protein 1 (Gene Name=ZBP1)

[Back to BioLiP]