Structure of PDB 4j9i Chain E Binding Site BS01

Receptor Information

>4j9i Chain E (length=57) Species: 9606 (Homo sapiens)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVN

Ligand information

>4j9i Chain F (length=10)

APTYSPPLPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j9i Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): Y70 D77 W99 W110 P112 N114 Y115
• Binding residue (residue number reindexed from 1): Y7 D14 W36 W47 P49 N51 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4j9i, PDBe:4j9i, PDBj:4j9i
• PDBsum: 4j9i
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)