Structure of PDB 4j9f Chain E Binding Site BS01

Receptor Information
>4j9f Chain E (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWV
PSNYITPVNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j9f Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
Resolution1.094 Å
Binding residue
(original residue number in PDB)
Y70 S75 D77 E98 W99 W110 P112 N114 Y115
Binding residue
(residue number reindexed from 1)
Y9 S14 D16 E37 W38 W49 P51 N53 Y54
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:4j9f, PDBe:4j9f, PDBj:4j9f
PDBsum4j9f
PubMed
UniProtP00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)

[Back to BioLiP]