Structure of PDB 4ht6 Chain E Binding Site BS01

Receptor Information
>4ht6 Chain E (length=86) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNT
WHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA
Ligand information
>4ht6 Chain F (length=11) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ITYDKGIQTDQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ht6 The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K12 K63 N64 F65 G66 S67 Y68 V69 T70 H71 K73 Y78 Y80
Binding residue
(residue number reindexed from 1)		K6 K57 N58 F59 G60 S61 Y62 V63 T64 H65 K67 Y72 Y74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008574 plus-end-directed microtubule motor activity
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0006913 nucleocytoplasmic transport
GO:0007017 microtubule-based process
GO:0015031 protein transport
GO:0030473 nuclear migration along microtubule
GO:0040001 establishment of mitotic spindle localization
GO:0051028 mRNA transport
GO:0051292 nuclear pore complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005881 cytoplasmic microtubule
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex
GO:0034399 nuclear periphery
GO:1990429 peroxisomal importomer complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ht6, PDBe:4ht6, PDBj:4ht6
PDBsum4ht6
PubMed23761070
UniProtQ02647|DYL1_YEAST Dynein light chain 1, cytoplasmic (Gene Name=DYN2)

[Back to BioLiP]