Structure of PDB 4hre Chain E Binding Site BS01

Receptor Information
>4hre Chain E (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLA
VDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hre SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
Resolution2.7852 Å
Binding residue
(original residue number in PDB)		D59 Q69 S73 A76 G77
Binding residue
(residue number reindexed from 1)		D59 Q69 S73 A76 G77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0042803 protein homodimerization activity
GO:0044325 transmembrane transporter binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0001765 membrane raft assembly
GO:0006900 vesicle budding from membrane
GO:0010756 positive regulation of plasminogen activation
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043547 positive regulation of GTPase activity
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0051496 positive regulation of stress fiber assembly
GO:0051894 positive regulation of focal adhesion assembly
GO:0072659 protein localization to plasma membrane
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016363 nuclear matrix
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hre, PDBe:4hre, PDBj:4hre
PDBsum4hre
PubMed23415230
UniProtP60903|S10AA_HUMAN Protein S100-A10 (Gene Name=S100A10)

[Back to BioLiP]