Structure of PDB 4h44 Chain E Binding Site BS01

Receptor Information
>4h44 Chain E (length=31) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLAIVAYIGFLALFTGIAAGLLFGLRSAKIL
Ligand information
>4h44 Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAILTLGWVSLLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h44 Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
Resolution2.7 Å
Binding residue
(original residue number in PDB)		A3 Y7 F10 L11 F14 T15
Binding residue
(residue number reindexed from 1)		A3 Y7 F10 L11 F14 T15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h44, PDBe:4h44, PDBj:4h44
PDBsum4h44
PubMed23440205
UniProtQ8YVQ2|PETL_NOSS1 Cytochrome b6-f complex subunit 6 (Gene Name=petL)

[Back to BioLiP]