Structure of PDB 4h3h Chain E Binding Site BS01

Receptor Information

>4h3h Chain E (length=192) Species: 9606 (Homo sapiens)

SSPLRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKP
NVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCK
DLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGA
FLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

Ligand information

>4h3h Chain F (length=8)

PTSPSYSP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4h3h An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): S12 S13 S14 N15 Q16 N17 R18 K43 P45 P49 P52 M84 R114 D143 H145
• Binding residue (residue number reindexed from 1): S10 S11 S12 N13 Q14 N15 R16 K41 P43 P47 P50 M82 R112 D141 H143

Enzymatic activity

• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.

Gene Ontology

Molecular Function

• GO:0004721 phosphoprotein phosphatase activity
• GO:0004722 protein serine/threonine phosphatase activity
• GO:0005515 protein binding
• GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
• GO:0017018 myosin phosphatase activity

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0006369 termination of RNA polymerase II transcription
• GO:0006397 mRNA processing
• GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

External links

• PDB: RCSB:4h3h, PDBe:4h3h, PDBj:4h3h
• PDBsum: 4h3h
• PubMed: 23070812
• UniProt: Q9NP77|SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Gene Name=SSU72)