Structure of PDB 4h25 Chain E Binding Site BS01

Receptor Information
>4h25 Chain E (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTE
LGRPVAESWNSQKDLLEQKRGQVDTYCRHNYGVVESFTVQRRVHPQVTVY
PAKTNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTL
VMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h25 T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		P5 F7 L11 S13 F26 E28 Y30 W61 Q64 K71 Q74 T77 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		P3 F5 L9 S11 F24 E26 Y28 W59 Q62 K69 Q72 T75 Y76 H79 N80 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0002504 antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h25, PDBe:4h25, PDBj:4h25
PDBsum4h25
PubMed23091041
UniProtB8YAC7

[Back to BioLiP]