Structure of PDB 4gk5 Chain E Binding Site BS01

Receptor Information
>4gk5 Chain E (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEK
LDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gk5 Structural insights into the assembly of human translesion polymerase complexes
Resolution3.21 Å
Binding residue
(original residue number in PDB)
A1160 L1171 W1175 I1179 M1183 D1186
Binding residue
(residue number reindexed from 1)
A5 L16 W20 I24 M28 D31
Enzymatic activity
Enzyme Commision number 2.7.7.-
External links
PDB RCSB:4gk5, PDBe:4gk5, PDBj:4gk5
PDBsum4gk5
PubMed23143872
UniProtQ9UBZ9|REV1_HUMAN DNA repair protein REV1 (Gene Name=REV1)

[Back to BioLiP]