Structure of PDB 4ftv Chain E Binding Site BS01

Receptor Information
>4ftv Chain E (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSV
GAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGLMSA
QPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATG
FYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSAT
FWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Ligand information
>4ftv Chain C (length=9) Species: 39015 (Human T-cell lymphotropic virus type 1 (african isolate)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLFGYPVYV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ftv Structure of a high affinity TCR reveals native binding to MHC with enhanced peptide specificity
Resolution2.74 Å
Binding residue
(original residue number in PDB)		E30 R95 L98 M99 A101 P103
Binding residue
(residue number reindexed from 1)		E30 R94 L97 M98 A100 P102
External links