Structure of PDB 4ez1 Chain E Binding Site BS01

Receptor Information
>4ez1 Chain E (length=202) Species: 6500 (Aplysia californica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQANLMRLKSDLFMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYY
EQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQ
IAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEID
LKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFR
ER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ez1 Pairwise interaction of alpha-conotoxin BuIA Pro6 with the beta subunit of nicotinic acetylcholine receptor
Resolution2.49 Å
Binding residue
(original residue number in PDB)		Y55 V108 M116 I118 D164 S167
Binding residue
(residue number reindexed from 1)		Y50 V103 M111 I113 D159 S162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0034220 monoatomic ion transmembrane transport
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ez1, PDBe:4ez1, PDBj:4ez1
PDBsum4ez1
PubMed
UniProtQ8WSF8

[Back to BioLiP]