Structure of PDB 4dco Chain E Binding Site BS01

Receptor Information
>4dco Chain E (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMH
ILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dco Molecular insight into the role of the leucine residue on the L2 loop in the catalytic activity of caspases 3 and 7
Resolution1.7 Å
Binding residue
(original residue number in PDB)
Y1204 S1205 W1206 R1207 N1208 S1209 S1249
Binding residue
(residue number reindexed from 1)
Y20 S21 W22 R23 N24 S25 S65
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4dco, PDBe:4dco, PDBj:4dco
PDBsum4dco
PubMed22304005
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]