Structure of PDB 4chg Chain E Binding Site BS01

Receptor Information
>4chg Chain E (length=133) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTD
EDTAALRRRLLQRFAIEPLAPVRDAEDAAAIHRRCRRGGDTVRSLIDCQV
AAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Ligand information
>4chg Chain H (length=29) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LVGEPLGRDEALALQGSGFDFSNDEIESF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4chg Crystal Structure of the Vapbc-15 Complex from Mycobacterium Tuberculosis Reveals a Two-Metal Ion Dependent Pin-Domain Ribonuclease And a Variable Mode of Toxin-Antitoxin Assembly.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D76 L104 C124 G125 R127
Binding residue
(residue number reindexed from 1)		D77 L105 C125 G126 R128
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4chg, PDBe:4chg, PDBj:4chg
PDBsum4chg
PubMed25450593
UniProtP9WF97|VPC15_MYCTU Ribonuclease VapC15 (Gene Name=vapC15)

[Back to BioLiP]