Structure of PDB 4cfh Chain E Binding Site BS01

Receptor Information
>4cfh Chain E (length=301) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPL
WDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQD
SFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILK
FLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHR
VSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFE
GVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVL
T
Ligand information
>4cfh Chain C (length=21) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGSHTIEFFEMCANLIKILAQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cfh Structure of Mammalian Ampk and its Regulation by Adp
Resolution3.24 Å
Binding residue
(original residue number in PDB)		W74 S76 Q79 F81 S159 G160 N161
Binding residue
(residue number reindexed from 1)		W51 S53 Q56 F58 S136 G137 N138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004679 AMP-activated protein kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016208 AMP binding
GO:0019887 protein kinase regulator activity
GO:0019901 protein kinase binding
GO:0043531 ADP binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0010628 positive regulation of gene expression
GO:0031669 cellular response to nutrient levels
GO:0051170 import into nucleus
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031588 nucleotide-activated protein kinase complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cfh, PDBe:4cfh, PDBj:4cfh
PDBsum4cfh
PubMed21399626
UniProtP80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=Prkag1)

[Back to BioLiP]