Structure of PDB 4aso Chain E Binding Site BS01

Receptor Information
>4aso Chain E (length=93) Species: 1428 (Bacillus thuringiensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKP
TVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aso Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems.
Resolution7.0 Å
Binding residue
(original residue number in PDB)		T44 P55 F58
Binding residue
(residue number reindexed from 1)		T39 P50 F53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0042802 identical protein binding
Biological Process
GO:0030541 plasmid partitioning

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4aso, PDBe:4aso, PDBj:4aso
PDBsum4aso
PubMed23010931
UniProtQ8KNP2|TUBR_BACTI DNA-binding transcriptional repressor TubR (Gene Name=tubR)

[Back to BioLiP]