Structure of PDB 4aa6 Chain E Binding Site BS01

Receptor Information
>4aa6 Chain E (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGDYMCPATNQCTIDKNRR
KSCQACRLRKCYEVGMMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aa6 The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y195 H196 Y197 K206 K210
Binding residue
(residue number reindexed from 1)		Y13 H14 Y15 K24 K28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4aa6, PDBe:4aa6, PDBj:4aa6
PDBsum4aa6
PubMed7735836
UniProtP03372|ESR1_HUMAN Estrogen receptor (Gene Name=ESR1)

[Back to BioLiP]