Structure of PDB 4a75 Chain E Binding Site BS01

Receptor Information

>4a75 Chain E (length=88) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYME
GFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN

Ligand information

>4a75 Chain F (length=5) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4a75 The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
Resolution	1.75 Å
Binding residue (original residue number in PDB)	K38 W39 N41 F46 F48 D64 F66 H68 S93 K95
Binding residue (residue number reindexed from 1)	K13 W14 N16 F21 F23 D39 F41 H43 S68 K70
Binding affinity	PDBbind-CN: Kd=169nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:4a75, PDBe:4a75, PDBj:4a75
PDBsum	4a75
PubMed	22570413
UniProt	B4F6I0

[Back to BioLiP]