Structure of PDB 3zpl Chain E Binding Site BS01

Receptor Information
>3zpl Chain E (length=160) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKL
AESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQF
AILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQ
PSEADLPWLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zpl Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R32 M61 T62 R72 S76 H77 R90 R98 G99 Q100
Binding residue
(residue number reindexed from 1)		R31 M60 T61 R71 S75 H76 R89 R97 G98 Q99
Binding affinityPDBbind-CN: Kd=2.4nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zpl, PDBe:3zpl, PDBj:3zpl
PDBsum3zpl
PubMed23748564
UniProtQ9KYU1

[Back to BioLiP]