Structure of PDB 3zc0 Chain E Binding Site BS01

Receptor Information

>3zc0 Chain E (length=190) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQEL
KKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEID
LEVTPAAFLNGFAAAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLM
EFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN

Ligand information

>3zc0 Chain N (length=15) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uucgacgcgucgaau

...............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3zc0 Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
Resolution	2.982 Å
Binding residue (original residue number in PDB)	R25 E80 V169
Binding residue (residue number reindexed from 1)	R25 E80 V169

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0042802	identical protein binding
GO:0043565	sequence-specific DNA binding
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:3zc0, PDBe:3zc0, PDBj:3zc0
PDBsum	3zc0
PubMed	23353787
UniProt	O28024

[Back to BioLiP]