Structure of PDB 3wuu Chain E Binding Site BS01

Receptor Information

>3wuu Chain E (length=44) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET

Ligand information

>3wuu Chain F (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LAVGPPSLNYPGY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3wuu Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
Resolution	2.904 Å
Binding residue (original residue number in PDB)	N181 E192
Binding residue (residue number reindexed from 1)	N14 E25

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0000281	mitotic cytokinesis
GO:0051896	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process

External links

PDB	RCSB:3wuu, PDBe:3wuu, PDBj:3wuu
PDBsum	3wuu
PubMed	26392564
UniProt	Q53EZ4\|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]