Structure of PDB 3w6k Chain E Binding Site BS01

Receptor Information
>3w6k Chain E (length=81) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GALKPAKAIVEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQDCR
REERGIQLVELGGVFLLATKKEHAPYLKKLV
Ligand information
>3w6k Chain D (length=16) Species: 1422 (Geobacillus stearothermophilus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ERALLFTKPPSDLSAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3w6k Molecular basis of SMC ATPase activation: role of internal structural changes of the regulatory subcomplex ScpAB
Resolution2.374 Å
Binding residue
(original residue number in PDB)		F26 V92
Binding residue
(residue number reindexed from 1)		F15 V81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051304 chromosome separation

View graph for
Biological Process
External links
PDB RCSB:3w6k, PDBe:3w6k, PDBj:3w6k
PDBsum3w6k
PubMed23541893
UniProtA0A0E0TE00

[Back to BioLiP]