Structure of PDB 3ufd Chain E Binding Site BS01

Receptor Information
>3ufd Chain E (length=76) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ufd The structural basis of differential DNA sequence recognition by restriction-modification controller proteins.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T23 Q24 R35 S39 R43
Binding residue
(residue number reindexed from 1)		T22 Q23 R34 S38 R42
Binding affinityPDBbind-CN: Kd=0.61nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ufd, PDBe:3ufd, PDBj:3ufd
PDBsum3ufd
PubMed22941636
UniProtQ8GGH0

[Back to BioLiP]