Structure of PDB 3u61 Chain E Binding Site BS01

Receptor Information
>3u61 Chain E (length=294) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSP
GTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQK
VIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRC
RVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFP
DFRKTIGELDSGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEE
IYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u61 How a DNA polymerase clamp loader opens a sliding clamp.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K80 I81 R85
Binding residue
(residue number reindexed from 1)		K78 I79 R83
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006281 DNA repair
GO:0039686 bidirectional double-stranded viral DNA replication
GO:0039693 viral DNA genome replication
Cellular Component
GO:0005663 DNA replication factor C complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3u61, PDBe:3u61, PDBj:3u61
PDBsum3u61
PubMed22194570
UniProtP04526|LOADL_BPT4 Sliding-clamp-loader large subunit (Gene Name=44)

[Back to BioLiP]