Structure of PDB 3t5q Chain E Binding Site BS01

Receptor Information
>3t5q Chain E (length=301) Species: 300180 (Mopeia Lassa virus reassortant 29) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKE
RRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLE
KLKSKLSSQQLDQRRALLNMIGVRVWDVKNAELLSNQFGTMPSLTLACLT
KQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSS
LNISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSILKVKKA
LGMFISDTPGERNPYENILYKICLSGDGWPYIASRTSITGRAWENTVVDL
E
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3t5q Crystal structure of the Lassa virus nucleoprotein-RNA complex reveals a gating mechanism for RNA binding.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		W164 A169 N174 F176 G177 T178 Y213 N215 T216 S237 S238 L239 N240 S247 L248 K253 R300 Y308 K309 R323 R329
Binding residue
(residue number reindexed from 1)		W126 A131 N136 F138 G139 T140 Y175 N177 T178 S199 S200 L201 N202 S209 L210 K215 R262 Y270 K271 R285 R291
Enzymatic activity
Enzyme Commision number 3.1.13.-
External links