Structure of PDB 3siu Chain E Binding Site BS01

Receptor Information
>3siu Chain E (length=236) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDY
IRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELE
RLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVA
GGLTNLSKMPACNIMLLGASVLPHTGYIYHSDIVQSLPPDLRRKAARLVA
AKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ
Ligand information
>3siu Chain F (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuguccaaugagcgcauagugagggcag
<<<<<<.....<.......>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3siu Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
Resolution2.626 Å
Binding residue
(original residue number in PDB)		C247 N248 M250 L251 L252 H270 R289 R293 A297 K298 K327
Binding residue
(residue number reindexed from 1)		C162 N163 M165 L166 L167 H174 R193 R197 A201 K202 K231
Binding affinityPDBbind-CN: Kd=8uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3siu, PDBe:3siu, PDBj:3siu
PDBsum3siu
PubMed21784869
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]