Structure of PDB 3qym Chain E Binding Site BS01

Receptor Information
>3qym Chain E (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQI
KVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSH
LIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV
GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qym Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S272 R304 A307 R311
Binding residue
(residue number reindexed from 1)		S148 R180 A183 R187
Binding affinityPDBbind-CN: Kd=11.7uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qym, PDBe:3qym, PDBj:3qym
PDBsum3qym
PubMed21464285
UniProtQ9H3D4|P63_HUMAN Tumor protein 63 (Gene Name=TP63)

[Back to BioLiP]