Structure of PDB 3qsu Chain E Binding Site BS01

Receptor Information

>3qsu Chain E (length=61) Species: 889933 (Staphylococcus aureus subsp. aureus ECT-R 2)

ENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHL
IYKHAISTYTV

Ligand information

>3qsu Chain P (length=4)

aaaa

....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3qsu Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): F25 F26 N28 G29 F30 Q31 S61 T62
• Binding residue (residue number reindexed from 1): F21 F22 N24 G25 F26 Q27 S57 T58
• Binding affinity: PDBbind-CN: Kd=19.5nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 04:35:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3qsu', asym_id = 'E', bs = 'BS01', title = 'Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3qsu', asym_id='E', bs='BS01', title='Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003723,0006355', uniprot = '', pdbid = '3qsu', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0006355', uniprot='', pdbid='3qsu', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>