Structure of PDB 3o2q Chain E Binding Site BS01

Receptor Information

>3o2q Chain E (length=192) Species: 9606 (Homo sapiens)

SSPLRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKP
NVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCK
DLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGA
FLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

Ligand information

>3o2q Chain F (length=6)

PTSPSY

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3o2q Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): S12 S13 S14 N15 Q16 N17 R18 K43 L44 P45 G46 P47 A48 D143
• Binding residue (residue number reindexed from 1): S10 S11 S12 N13 Q14 N15 R16 K41 L42 P43 G44 P45 A46 D141

Enzymatic activity

• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.

Gene Ontology

Molecular Function

• GO:0004721 phosphoprotein phosphatase activity
• GO:0004722 protein serine/threonine phosphatase activity
• GO:0005515 protein binding
• GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
• GO:0017018 myosin phosphatase activity

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0006369 termination of RNA polymerase II transcription
• GO:0006397 mRNA processing
• GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

External links

• PDB: RCSB:3o2q, PDBe:3o2q, PDBj:3o2q
• PDBsum: 3o2q
• PubMed: 20861839
• UniProt: Q9NP77|SSU72_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Gene Name=SSU72)