Structure of PDB 3mv9 Chain E Binding Site BS01

Receptor Information
>3mv9 Chain E (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIAYY
NGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSARSGEL
FFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPD
HVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQN
PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Ligand information
>3mv9 Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGEADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mv9 Allelic polymorphism in the T cell receptor and its impact on immune responses
Resolution2.7 Å
Binding residue
(original residue number in PDB)		D29 L30 Y40 Y57 S107 A108 R109
Binding residue
(residue number reindexed from 1)		D29 L30 Y33 Y50 S94 A95 R96
External links