Structure of PDB 3mv8 Chain E Binding Site BS01

Receptor Information
>3mv8 Chain E (length=242) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHY
YNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSARSGE
LFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYP
DHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQ
NPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Ligand information
>3mv8 Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGEADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mv8 Allelic polymorphism in the T cell receptor and its impact on immune responses
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D29 L30 Y40 H55 Y57 S107 A108 R109
Binding residue
(residue number reindexed from 1)		D30 L31 Y34 H49 Y51 S95 A96 R97
External links