Structure of PDB 3mv7 Chain E Binding Site BS01

Receptor Information
>3mv7 Chain E (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYY
NGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSARSGEL
FFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPD
HVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQN
PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Ligand information
>3mv7 Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGEADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mv7 Allelic polymorphism in the T cell receptor and its impact on immune responses
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D29 L30 Y40 Q55 Y57 S107 A108 R109
Binding residue
(residue number reindexed from 1)		D29 L30 Y33 Q48 Y50 S94 A95 R96
External links