Structure of PDB 3mbe Chain E Binding Site BS01

Receptor Information
>3mbe Chain E (length=184) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEF
GQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVL
LGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKL
SYLTFIPSDDDIYDCKVEHWGLEEPVLKHWSSAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mbe The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
Resolution2.886 Å
Binding residue
(original residue number in PDB)		I52 L53 N62 A65 E66 H68 N69 I72
Binding residue
(residue number reindexed from 1)		I54 L55 N64 A67 E68 H70 N71 I74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mbe, PDBe:3mbe, PDBj:3mbe
PDBsum3mbe
PubMed20407212
UniProtP04228|HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]