Structure of PDB 3m9e Chain E Binding Site BS01

Receptor Information
>3m9e Chain E (length=102) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIID
KVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREEL
QK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3m9e Structure of a thyroid hormone receptor DNA-binding domain homodimer bound to an inverted palindrome DNA response element.
Resolution2.406 Å
Binding residue
(original residue number in PDB)		H117 Y118 R131 L177 V178 L179 R184 K187
Binding residue
(residue number reindexed from 1)		H14 Y15 R28 L74 V75 L76 R81 K84
Binding affinityPDBbind-CN: Kd=0.13uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3m9e, PDBe:3m9e, PDBj:3m9e
PDBsum3m9e
PubMed20610536
UniProtP18113|THB_RAT Thyroid hormone receptor beta (Gene Name=Thrb)

[Back to BioLiP]