Structure of PDB 3m7n Chain E Binding Site BS01

Receptor Information
>3m7n Chain E (length=248) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPEKLIVDGLRLDGRKFDELRPIKIEASVLKRADGSCYLEMGKNKVIAA
VFGPREVHPEHLQDPSKAIIRYRYNMAPFSVEERKRPGPDRRSIEISKVS
KEAFEAVIMKELFPRSAIDIFVEVLQADAGSRTACLNAASVALVDAGVPM
KGMITSVAVGKADGQLVLDPMKEEDNFGEADMPFAFLIRNGKIESIALLQ
MDGRMTRDEVKQAIELAKKGALQIYEMQREAILRRYIEVGEEMDEITE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3m7n Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V86 R96 R97 D133 S136 R137 D180
Binding residue
(residue number reindexed from 1)		V81 R91 R92 D128 S131 R132 D175
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006401 RNA catabolic process
GO:0016075 rRNA catabolic process
Cellular Component
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3m7n, PDBe:3m7n, PDBj:3m7n
PDBsum3m7n
PubMed20392821
UniProtO29757|RRP41_ARCFU Exosome complex component Rrp41 (Gene Name=rrp41)

[Back to BioLiP]