Structure of PDB 3lnz Chain E Binding Site BS01

Receptor Information
>3lnz Chain E (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVY
CSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lnz Systematic mutational analysis of peptide inhibition of the p53-MDM2/MDMX interactions.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		L54 L57 G58 I61 M62 Y67 Q72 H73 V93 H96 Y100
Binding residue
(residue number reindexed from 1)		L28 L31 G32 I35 M36 Y41 Q46 H47 V67 H70 Y74
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lnz, PDBe:3lnz, PDBj:3lnz
PDBsum3lnz
PubMed20226197
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]