Structure of PDB 3law Chain E Binding Site BS01

Receptor Information

>3law Chain E (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDR
LVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDE
FLIQASPRDPENFPFVVLGNKIDFENRQVATKRAQAWCYSKNNIPYFETS
AKEAINVEQAFQTIARNALKQETEV

Ligand information

Ligand ID

InChI

InChI=1S/Mg/q+2

InChIKey

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Name

MAGNESIUM ION

PDB chain

3law Chain E Residue 1401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3law Disease mutations in Rab7 result in unregulated nucleotide exchange and inappropriate activation.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	T22 T40 D63
Binding residue (residue number reindexed from 1)	T17 T35 D58
Annotation score	1

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0031267	small GTPase binding
GO:1905394	retromer complex binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0006622	protein targeting to lysosome
GO:0006897	endocytosis
GO:0006914	autophagy
GO:0007174	epidermal growth factor catabolic process
GO:0008333	endosome to lysosome transport
GO:0009617	response to bacterium
GO:0015031	protein transport
GO:0016042	lipid catabolic process
GO:0019076	viral release from host cell
GO:0022615	protein to membrane docking
GO:0036466	synaptic vesicle recycling via endosome
GO:0042147	retrograde transport, endosome to Golgi
GO:0045022	early endosome to late endosome transport
GO:0045453	bone resorption
GO:0045732	positive regulation of protein catabolic process
GO:0046907	intracellular transport
GO:0048524	positive regulation of viral process
GO:0051650	establishment of vesicle localization
GO:0061724	lipophagy
GO:0090382	phagosome maturation
GO:0090383	phagosome acidification
GO:0090385	phagosome-lysosome fusion
GO:0098943	neurotransmitter receptor transport, postsynaptic endosome to lysosome
GO:0099003	vesicle-mediated transport in synapse
GO:0099638	endosome to plasma membrane protein transport
GO:1903542	negative regulation of exosomal secretion
GO:1903543	positive regulation of exosomal secretion
GO:1905366	negative regulation of intralumenal vesicle formation

	Cellular Component
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005770	late endosome
GO:0005794	Golgi apparatus
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0030667	secretory granule membrane
GO:0030670	phagocytic vesicle membrane
GO:0030672	synaptic vesicle membrane
GO:0030904	retromer complex
GO:0031902	late endosome membrane
GO:0031966	mitochondrial membrane
GO:0033162	melanosome membrane
GO:0034045	phagophore assembly site membrane
GO:0043231	intracellular membrane-bounded organelle
GO:0045335	phagocytic vesicle
GO:0070062	extracellular exosome
GO:0097208	alveolar lamellar body
GO:0098588	bounding membrane of organelle
GO:0098830	presynaptic endosome
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3law, PDBe:3law, PDBj:3law
PDBsum	3law
PubMed	20028791
UniProt	P51149\|RAB7A_HUMAN Ras-related protein Rab-7a (Gene Name=RAB7A)

[Back to BioLiP]