Structure of PDB 3kxb Chain E Binding Site BS01

Receptor Information
>3kxb Chain E (length=90) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQE
ASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>3kxb Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kxb Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V46 R49 R63 K64 L65 R69 R83 K115
Binding residue
(residue number reindexed from 1)		V2 R5 R19 K20 L21 R25 R39 K71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3kxb, PDBe:3kxb, PDBj:3kxb
PDBsum3kxb
PubMed20100606
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]