Structure of PDB 3kwq Chain E Binding Site BS01

Receptor Information
>3kwq Chain E (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>3kwq Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kwq Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 V46 R49 R63 K64 L65 R69
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 V9 R12 R26 K27 L28 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3kwq, PDBe:3kwq, PDBj:3kwq
PDBsum3kwq
PubMed20100606
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]