Structure of PDB 3fma Chain E Binding Site BS01

Receptor Information
>3fma Chain E (length=85) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETL
GINDIFITLGELMTKLEKYDTDPFTTFDKLHVQTT
Ligand information
>3fma Chain P (length=7) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APPPGLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fma SMY2-type GYF domain recognition in mRNA surveillance complexes
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y20 D22 H28 W39 Y44 F45
Binding residue
(residue number reindexed from 1)		Y9 D11 H17 W28 Y33 F34
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3fma, PDBe:3fma, PDBj:3fma
PDBsum3fma
PubMed
UniProtP32909|SMY2_YEAST Protein SMY2 (Gene Name=SMY2)

[Back to BioLiP]