Structure of PDB 3dpq Chain E Binding Site BS01

Receptor Information
>3dpq Chain E (length=203) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVDDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQK
LME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dpq Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T403 M404 T409 V425 F426 S427 T428 A429 E430 N432 Q433 A435 T437 N458 G468 H541
Binding residue
(residue number reindexed from 1)		T15 M16 T21 V37 F38 S39 T40 A41 E42 N44 Q45 A47 T49 N70 G80 H153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:3dpq, PDBe:3dpq, PDBj:3dpq
PDBsum3dpq
PubMed19103929
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]