Structure of PDB 3c01 Chain E Binding Site BS01

Receptor Information
>3c01 Chain E (length=88) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLA
RSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVENAGKDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c01 Structural analysis of the essential self-cleaving type III secretion proteins EscU and SpaS.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H261 I262 I264 G265 I266 S279 A289 V290 Y293 P300 V301 I302 V303 D304 Y318 E340
Binding residue
(residue number reindexed from 1)		H3 I4 I6 G7 I8 S21 A31 V32 Y35 P42 V43 I44 V45 D46 Y60 E82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3c01, PDBe:3c01, PDBj:3c01
PDBsum3c01
PubMed18451864
UniProtP40702|SPAS_SALTY Surface presentation of antigens protein SpaS (Gene Name=spaS)

[Back to BioLiP]