Structure of PDB 3b6f Chain E Binding Site BS01

Receptor Information
>3b6f Chain E (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRI
RGERA
Ligand information
>3b6f Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggaatccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3b6f Site selectivity of platinum anticancer therapeutics
Resolution3.45 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 R42 P43 G44 V46 R63 K64 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		H9 R10 Y11 R12 P13 G14 V16 R33 K34 L35 P36 R39 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3b6f, PDBe:3b6f, PDBj:3b6f
PDBsum3b6f
PubMed18157123
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]