Structure of PDB 3azi Chain E Binding Site BS01

Receptor Information

>3azi Chain E (length=99) Species: 9606 (Homo sapiens)

KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Ligand information

>3azi Chain I (length=145)

atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3azi Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): H39 R40 Y41 G44 V46 R49 K56 R63 K64 L65 R69
• Binding residue (residue number reindexed from 1): H3 R4 Y5 G8 V10 R13 K20 R27 K28 L29 R33

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3azi, PDBe:3azi, PDBj:3azi
• PDBsum: 3azi
• PubMed: 21812398
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)