Structure of PDB 3ax2 Chain E Binding Site BS01

Receptor Information
>3ax2 Chain E (length=65) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQ
QTLPPPVFQMLLTKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ax2 Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E78 L106
Binding residue
(residue number reindexed from 1)		E17 L45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ax2, PDBe:3ax2, PDBj:3ax2
PDBsum3ax2
PubMed21591667
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]